AibGenesis™ Mouse Anti-LRRC29 Antibody (CBMOAB-49200FYA)


Cat: CBMOAB-49200FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49200FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO49200FYA 100 µg
MO-AB-04168W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04168W 100 µg
MO-AB-11592W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11592W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO49200FYA
SpecificityThis antibody binds to Rhesus LRRC29.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LRRC29 Antibody is a mouse antibody against LRRC29. It can be used for LRRC29 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeucine-rich repeat-containing protein 29; LRRC29
UniProt IDH9F4A1
Protein RefseqThe length of the protein is 91 amino acids long.
The sequence is show below: LSHCTRVSDKGWAQAASSWPRLQHLNLSSCSQLTEQTLDAIGQACRQLRVLDVAMCPGINMAAIRRFQAQLPQVSCVQSRFVGGADLTLTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry