AibGenesis™ Mouse Anti-lrrc57 Antibody (CBMOAB-85478FYA)


Cat: CBMOAB-85478FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-85478FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO85478FYA 100 µg
MO-AB-15087R Monoclonal Cattle (Bos taurus) WB, ELISA MO15087R 100 µg
MO-AB-18059W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18059W 100 µg
MO-AB-26847H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26847C 100 µg
MO-AB-58379W Monoclonal Marmoset WB, ELISA MO58379W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO85478FYA
SpecificityThis antibody binds to Zebrafish lrrc57.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish lrrc57 Antibody is a mouse antibody against lrrc57. It can be used for lrrc57 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeucine-rich repeat-containing protein 57; lrrc5
UniProt IDQ6DHL5
Protein RefseqThe length of the protein is 238 amino acids long.
The sequence is show below: MGNSALKAHLETSQKTGVFQLTGKGLTEFPEDLQKLTANLRTVDLSNNKIEELPAFIGSFQHLKSFTISCNKLTSLPNDIGKLKKLETLILNGNQLKQLPSSIGQLKSLRTLSLSGNQFKEFPSGLGTLRQLDVLDLSKNQIRVVPAEVAELQAIEINLNQNQISSVTQEVSRTPRLKVLRLEENCLELSSIPLSILTDSQVSLLSVEGNLFEVKKMRDLEGYDKYMERFTATKKKFA.
For Research Use Only | Not For Clinical Use.
Online Inquiry