AibGenesis™ Mouse Anti-LRTM1 Antibody (MO-AB-58417W)


Cat: MO-AB-58417W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-58417W Monoclonal Marmoset, Frog (Xenopus laevis) WB, ELISA MO58417W 100 µg
MO-AB-04919H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04919C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Frog (Xenopus laevis)
CloneMO58417W
SpecificityThis antibody binds to Marmoset LRTM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Marmoset LRTM1 Antibody is a mouse antibody against LRTM1. It can be used for LRTM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeucine-rich repeat and transmembrane domain-containing protein 1; LRTM1
UniProt IDF7IGJ2
Protein RefseqThe length of the protein is 344 amino acids long.
The sequence is show below: MKGELLLFSTVIVLLQVTCGCPDKCHCHSSTNFVDCSRQGLAEIPSHLPPQTRMLHLQDNQIHHLPAFAFRSVPWLMTLNLSNNSLSNLAPAAFHGLQYLQVLNLTQNSLLSLESRLFHSLPQLRELDLSSNNISHLPMSLGKTWENLTILAVQQNRLQQLDRALLESMLSVRLLFLKDNLWNCNCHLLGLKLWLEKFIYKGGITDGIICGSPDIWKGKDLLRIPYELYQPCPLPAPHPVSLQAQWQGSAHGVVLRPENHNSGERDLLECELKPKPRPANLRHAIATVIITGVVCGIVCLMMLAAAIYGCTYAAITATYHGGPLAQTNEPGKAEAKERFDSSPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry