AibGenesis™ Mouse Anti-LTP Antibody (CBMOAB-34547FYB)


Cat: CBMOAB-34547FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34547FYB Monoclonal WB, ELISA MO34547FYB 100 µg
CBMOAB-61926FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO61926FYC 100 µg
MO-DKB-0317RA Polyclonal WB 200 µL
MO-DKB-02108W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); C. reinhardtii (Chlamydomonas reinhardtii)
CloneMO34547FYB
SpecificityThis antibody binds to Rice LTP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice LTP Antibody is a mouse antibody against LTP. It can be used for LTP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNon-specific lipid-transfer protein 1; LTP 1; PAPI; LTP; Os12g0115100 LOC_Os12g02320
UniProt IDQ0IQK9
Protein RefseqThe length of the protein is 116 amino acids long.
The sequence is show below: MARAQLVLVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry