AibGenesis™ Mouse Anti-LYPD4 Antibody (CBMOAB-49373FYA)


Cat: CBMOAB-49373FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49373FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO49373FYA 100 µg
MO-AB-15182R Monoclonal Cattle (Bos taurus) WB, ELISA MO15182R 100 µg
MO-AB-26908H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26908C 100 µg
MO-AB-27088R Monoclonal Pig (Sus scrofa) WB, ELISA MO27088R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO49373FYA
SpecificityThis antibody binds to Rhesus LYPD4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LYPD4 Antibody is a mouse antibody against LYPD4. It can be used for LYPD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLYPD4
UniProt IDF6YWQ3
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: MGPQHLRLVQLFCLLGAISTLPRMSCGAGCYKTQKGTARGVVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTSLEPFVKLKASAPKSIISASRSCPTCVGEHTRDCLPNFVTTDSCPLAASTCYSSTLKLQAGFLNTTFLLMGCAREHNQLLADFHHIGSIKVTEVLNILEKSQIVGAASSRQGPAWGVLLGLLFAFRD.
For Research Use Only | Not For Clinical Use.
Online Inquiry