AibGenesis™ Mouse Anti-LYRM7 Antibody (CBMOAB-49383FYA)


Cat: CBMOAB-49383FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49383FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO49383FYA 100 µg
CBMOAB-85654FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO85654FYA 100 µg
MO-AB-04954H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04954C 100 µg
MO-AB-15192R Monoclonal Cattle (Bos taurus) WB, ELISA MO15192R 100 µg
MO-AB-18194W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18194W 100 µg
MO-AB-26920H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26920C 100 µg
MO-AB-45410W Monoclonal Horse (Equus caballus) WB, ELISA MO45410W 100 µg
MO-AB-58491W Monoclonal Marmoset WB, ELISA MO58491W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO49383FYA
SpecificityThis antibody binds to Rhesus LYRM7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAssembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus LYRM7 Antibody is a mouse antibody against LYRM7. It can be used for LYRM7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLYR motif-containing protein 7; LYRM7
UniProt IDI0FW79
Protein RefseqThe length of the protein is 104 amino acids long.
The sequence is show below: MAQAAKGLQLFKTLHRTRQQVFKNDVRALEAARIKINEEFKNNKSETSPKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry