AibGenesis™ Mouse Anti-macir Antibody (CBMOAB-61215FYC)


Cat: CBMOAB-61215FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61215FYC Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes) WB, ELISA MO61215FYC 100 µg
MO-AB-16968W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16968W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes)
CloneMO61215FYC
SpecificityThis antibody binds to Zebrafish macir.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay play a role in immune regulation through regulation of the macrophage function. Involved in the recruitment of macrophages in response to injury (PubMed:30659109). May also play a role in trafficking of proteins via its interaction with unc119 family cargo adapters. May play a role in ciliary membrane localization (PubMed:22085962).Regulates the macrophage function, by enhancing the resolution of inflammation and wound repair functions mediated by M2 macrophages. The regulation of macrophage function is, due at least in part, to the role of C5orf30 in regulating ability to inhibit glycolysis. Probably plays alaso a role in trafficking of proteins via its interaction with UNC119 and UNC119B cargo adapters: may help the release of UNC119 and UNC119B cargo or the recycling of UNC119 and UNC119B. May play a role in ciliary membrane localization via its interaction with UNC119B and protein transport into photoreceptor cells. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish macir Antibody is a mouse antibody against macir. It can be used for macir detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUNC119-binding protein C5orf30 homolog; macir
UniProt IDB3DHS1
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: MEMDASGASRAPISVLPAAEVKSTLKPEADKPRCSSTPCSPIKSTVSGYQILHMNSNYLVGFTTGEELLKLAQKWSSPDSSNTEALPSPIKKPVDLGLHRASRIYKAKSRYYQPYDIPAVNGRRRRRMPSSGDSCLKSIVSGEPSKALHGPLPLCLLKGKRVYSKSLDYLNLDKMSLREPVDTEVLQYQLQHLNLRGERVFTRNKT.
For Research Use Only | Not For Clinical Use.
Online Inquiry