AibGenesis™ Mouse Anti-MACROH2A2 Antibody (MO-AB-09084W)


Cat: MO-AB-09084W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09084W Monoclonal Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus) WB, ELISA MO09084W 100 µg
MO-AB-15230R Monoclonal Cattle (Bos taurus) WB, ELISA MO15230R 100 µg
MO-AB-23850W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23850W 100 µg
MO-AB-31652W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31652W 100 µg
MO-AB-45419W Monoclonal Horse (Equus caballus) WB, ELISA MO45419W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus)
CloneMO09084W
SpecificityThis antibody binds to Cat MACROH2A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat MACROH2A2 Antibody is a mouse antibody against MACROH2A2. It can be used for MACROH2A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2A; H2AFY2
UniProt IDM3VW87
Protein RefseqThe length of the protein is 372 amino acids long.
The sequence is show below: MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKAASGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry