Mouse Anti-MAG1 Antibody (CBMOAB-02137CR)


Cat: CBMOAB-02137CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02137CR Monoclonal Yeast, C. elegans (Caenorhabditis elegans) WB, ELISA MO02137CR 100 µg
CBMOAB-06283HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO06283HB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, C. elegans (Caenorhabditis elegans)
CloneMO02137CR
SpecificityThis antibody binds to Yeast MAG1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Yeast MAG1 Antibody is a mouse antibody against MAG1. It can be used for MAG1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNA-3-methyladenine glycosylase; EC 3.2.2.21; 3-methyladenine DNA glycosidase; 3MEA DNA glycosylase; MAG1; MAG; YER142C
UniProt IDP22134
Protein RefseqThe length of the protein is 296 amino acids long. The sequence is show below: MKLKREYDELIKADAVKEIAKELGSRPLEVALPEKYIARHEEKFNMACEHILEKDPSLFPILKNNEFTLYLKETQVPNTLEDYFIRLASTILSQQISGQAAESIKARVVSLYGGAFPDYKILFEDFKDPAKCAEIAKCGLSKRKMIYLESLAVYFTEKYKDIEKLFGQKDNDEEVIESLVTNVKGIGPWSAKMFLISGLKRMDVFAPEDLGIARGFSKYLSDKPELEKELMRERKVVKKSKIKHKKYNWKIYDDDIMEKCSETFSPYRSVFMFILWRLASTNTDAMMKAEENFVKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry