Mouse Anti-Maize GRP Antibody (MO-AB-48292W)


Cat: MO-AB-48292W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMaize (Zea mays)
CloneMO48292W
SpecificityThis antibody binds to Maize GRP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.
Product OverviewMouse Anti-Maize GRP Antibody is a mouse antibody against GRP. It can be used for GRP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlycine-rich RNA binding protein; Glycine-rich RNA-binding protein 2; GRP
UniProt IDO48554
Protein RefseqThe length of the protein is145 amino acids long.
The sequence is show below: MAASDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESKIILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKELDGRNITVNEAQSRGGRGGGGGGYGGGRRDGGGYGGGGGGYGGGRGGYGGGGGYGGANRGGGYGNNDGNWRN.
For Research Use Only | Not For Clinical Use.
Online Inquiry