Mouse Anti-Maize maf1 Antibody (MO-AB-48678W)


Cat: MO-AB-48678W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMaize (Zea mays)
CloneMO48678W
SpecificityThis antibody binds to Maize maf1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is similar to Maf1, a Saccharomyces cerevisiae protein highly conserved in eukaryotic cells. Yeast Maf1 is a negative effector of RNA polymerase III (Pol III). It responds to changes in the cellular environment and represses pol III transcription. Biochemical studies identified the initiation factor TFIIIB as a target for Maf1-dependent repression.
Product OverviewMouse Anti-Maize maf1 Antibody is a mouse antibody against maf1. It can be used for maf1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMFP1 attachment factor 1; maf1
UniProt IDQ9M7N5
Protein RefseqThe length of the protein is142 amino acids long.
The sequence is show below: MANEEPAPVTAPAAAAPAGGDHSPAFSFSIWPPTQRTRDAVVRRLVETLAGDTILCKRYGAVPAADAEPAARAIEAEAFDAVAAAGGAAASVEEGIEALQSYSKEVSRRLLDFVKSRSADAKADPPSAEALAPDAPEAQPAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry