Mouse Anti-Malaria parasite ACC1 Antibody (MO-AB-09579H)


Cat: MO-AB-09579H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMalaria parasite
CloneMO09579C
SpecificityThis antibody binds to Malaria parasite ACC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMultifunctional enzyme that catalyzes the carboxylation of acetyl-CoA, forming malonyl-CoA, which is used in the plastid for fatty acid synthesis and in the cytosol in various biosynthetic pathways including fatty acid elongation. Required for very long chain fatty acids elongation. Necessary for embryo and plant development. Plays a central function in embryo morphogenesis, especially in apical meristem development. Involved in cell proliferation and tissue patterning. May act as a repressor of cytokinin response.
Product OverviewThis product is a mouse antibody against ACC1. It can be used for ACC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcetyl-CoA carboxylase 1; ACC1
UniProt IDQ9U752
Protein RefseqThe length of the protein is 131 amino acids long.
The sequence is show below: SQGGGGKGIRKVENEYEIKKAYEQVQNELPNSPIFLMKVCNNVRHIEIQVVGDMYGNVCSLSGRDCTTQRRFQKIFEEGPPSVVPYPIFREMEKSSIRLTKMIKYRGAGTIEYLYDQINKKYFFLELNPRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry