Mouse Anti-Mallard ACC Antibody (MO-AB-22805H)
Cat: MO-AB-22805H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Mallard (Anas platyrhynchos) |
Clone | MO22805C |
Specificity | This antibody binds to Mallard ACC. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | ACCase subunit beta (acetyl-coenzyme A, carboxylase (subunit beta)) is a component of the acetyl coenzyme A carboxylase (ACC) complex. It is catalyzing carboxylation of acetyl-CoA to produce malonyl-CoA through its two catalytic activities, biotin carboxylase (BC) and carboxyltransferase (CT) |
Product Overview | This product is a mouse antibody against ACC. It can be used for ACC detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Acetyl-CoA carboxylase; ACC |
UniProt ID | G9LQB5 |
Protein Refseq | The length of the protein is 54 amino acids long. The sequence is show below: ASENPKLPELLHKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGL. |
See other products for " ACC "
MO-DKB-0018RA | Rabbit Anti-ACC Antibody (MO-DKB-0018RA) |
MO-DKB-0087RA | Guinea pig Anti-ACC Antibody (MO-DKB-0087RA) |
CBMOAB-00532FYA | Mouse Anti-D. melanogaster Acc Antibody (CBMOAB-00532FYA) |
MO-DKB-0017RA | Rabbit Anti-ACC Antibody (MO-DKB-0017RA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry