Mouse Anti-Mallard ENO1 Antibody (MO-AB-23189H)


Cat: MO-AB-23189H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMallard (Anas platyrhynchos)
CloneMO23189C
SpecificityThis antibody binds to Mallard ENO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy.
Product OverviewThis product is a mouse antibody against ENO1. It can be used for ENO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha enolase; ENO1
UniProt IDW6CS92
Protein RefseqThe length of the protein is 43 amino acids long.
The sequence is show below: DFKSPDDPSRYISPDQLADLYKGFVKNYPVVSIEDPFDQDDWX.
For Research Use Only | Not For Clinical Use.
Online Inquiry