Mouse Anti-Mallard ING3 Antibody (MO-AB-23325H)


Cat: MO-AB-23325H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMallard (Anas platyrhynchos)
CloneMO23325C
SpecificityThis antibody binds to Mallard ING3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed.
Product OverviewThis product is a mouse antibody against ING3. It can be used for ING3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInhibitor of growth protein; ING3
UniProt IDU3I353
Protein RefseqThe length of the protein is 403 amino acids long.
The sequence is show below: HKNLDENLTRMQFCFLETTDAMDQLEQRVNEFFMNAKKNKPEWREEQMTSIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKHNPSSHHSATDHVPEKKFKSEALLSTLTSDASKENTPGCRNNSSSSSSNNAYNTNSSQPLASYNLGSLSSGSGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGREFSLSRDSTGYSSSALASTLTQTLSSSNTDSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSALAQELSQQTAVIPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK.
See other products for " ING3 "
MO-AB-02566YMouse Anti-Chicken ING3 Antibody (MO-AB-02566Y)
CBMOAB-80872FYAMouse Anti-Zebrafish ing3 Antibody (CBMOAB-80872FYA)
MO-AB-08498YMouse Anti-Rabbit ING3 Antibody (MO-AB-08498Y)
MO-AB-00665LMouse Anti-Elephant ING3 Antibody (MO-AB-00665L)
MO-AB-31310WMouse Anti-Dog ING3 Antibody (MO-AB-31310W)
MO-AB-06579YMouse Anti-O. anatinus ING3 Antibody (MO-AB-06579Y)
MO-AB-33321HMouse Anti-Nile tilapia ing3 Antibody (MO-AB-33321H)
MO-AB-20431WMouse Anti-Chimpanzee ING3 Antibody (MO-AB-20431W)
MO-AB-45167WMouse Anti-Horse ING3 Antibody (MO-AB-45167W)
MO-AB-15811YMouse Anti-Sheep ING3 Antibody (MO-AB-15811Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry