Mouse Anti-Mallard MED17 Antibody (MO-AB-23427H)


Cat: MO-AB-23427H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMallard (Anas platyrhynchos)
CloneMO23427C
SpecificityThis antibody binds to Mallard MED17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.
Product OverviewThis product is a mouse antibody against MED17. It can be used for MED17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator of RNA polymerase II transcription subunit 18; MED18
UniProt IDR0M0R0
Protein RefseqThe length of the protein is 641 amino acids long.
The sequence is show below: SLLHRLRGLCDNMEPETFLDHEMVFLLKGQQASPFVLRARRXXXXXXXXXXLRYLGQPEIGDKNRHALVRNCVDIATSDNLTDFLVEMGFRMDHEFVAKGHVFRKGIMKIVVYKIFRILMPGNTDNIEPLSLSYLVELNVVAPAGQDVVSDDMRNFAEQLKPLVHLEKIDPKRLM.
For Research Use Only | Not For Clinical Use.
Online Inquiry