Mouse Anti-Mallard SLC2A2 Antibody (MO-AB-23721H)


Cat: MO-AB-23721H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMallard (Anas platyrhynchos)
CloneMO23721C
SpecificityThis antibody binds to Mallard SLC2A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. The encoded protein mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor. Mutations in this gene are associated with susceptibility to diseases, including Fanconi-Bickel syndrome and noninsulin-dependent diabetes mellitus (NIDDM). Alternative splicing results in multiple transcript variants of this gene.
Product OverviewThis product is a mouse antibody against SLC2A2. It can be used for SLC2A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSolute carrier family 2 facilitated glucose transporter member 2; SLC2A2
UniProt IDW8P5B2
Protein RefseqThe length of the protein is 347 amino acids long.
The sequence is show below: RVSEVSPTALRGALGTLHQLAIVTGILISQVLGLDFLLGNDEMWPLLLGLSGVAALLQFFLLLLCPESPRYLYIKLGKVEEAKKSLKRLRGNCDPMKEIAEMEKEKQEAASEKKVSIGQLFTSSKYRQAVIVALMVQISQQFSGINAIFYYSTNIFERAGVDQPVYATIGVGVVNTVFTVISVFLVEKAGRRSLFLAGLMGMLLSAVAMTVGLVLLSQFAWMSYVSMIAIFLFVIFFEVGPGPIPWFIVAELFSQGPRPAAIAIAGFCNWACNFIVGMCFQYIADLCGSYVFVIFAVLLLVFLLFAYLKVPETKGKSFEEIAAVFRRKKLPAKTMTELEELRGGEVA.
See other products for " slc2A2 "
MO-AB-46546WMouse Anti-Horse slc2A2 Antibody (MO-AB-46546W)
MO-AB-04007YMouse Anti-Chicken SLC2A2 Antibody (MO-AB-04007Y)
CBMOAB-58126FYAMouse Anti-Rhesus SLC2A2 Antibody (CBMOAB-58126FYA)
MO-AB-30104RMouse Anti-Pig SLC2A2 Antibody (MO-AB-30104R)
MO-AB-20351RMouse Anti-Cattle SLC2A2 Antibody (MO-AB-20351R)
CBMOAB-05885FYBMouse Anti-Zebrafish slc2a2 Antibody (CBMOAB-05885FYB)
MO-AB-17665YMouse Anti-Sheep SLC2A2 Antibody (MO-AB-17665Y)
MO-AB-07724HMouse Anti-Frog slc2a2 Antibody (MO-AB-07724H)
For Research Use Only | Not For Clinical Use.
Online Inquiry