Mouse Anti-MALSU1 Antibody (CBMOAB-49491FYA)


Cat: CBMOAB-49491FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49491FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO49491FYA 100 µg
MO-AB-15265R Monoclonal Cattle (Bos taurus) WB, ELISA MO15265R 100 µg
MO-AB-18140W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18140W 100 µg
MO-AB-26952H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26952C 100 µg
MO-AB-58561W Monoclonal Marmoset WB, ELISA MO58561W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO49491FYA
SpecificityThis antibody binds to Rhesus MALSU1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MALSU1 Antibody is a mouse antibody against MALSU1. It can be used for MALSU1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMALSU1
UniProt IDH9Z517
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MGPSACVARLLTPLMWRRAVSSVAGCAVGAEPGLQLLAMQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAERTVDEGRPESDAADHTGPKFDIDIMVSLLRQENARDICVIQVPPEMRYTDYFVIGSGTSTRHLHAMAFYIVKMYKHLKCKHDPHVKIEGKDTDDWMCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEEDDTSSVTPVEFKCE.
For Research Use Only | Not For Clinical Use.
Online Inquiry