Mouse Anti-Manf Antibody (CBMOAB-23437FYA)
Cat: CBMOAB-23437FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-23437FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO23437FYA | 100 µg | ||
| CBMOAB-50727FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO50727FYA | 100 µg | ||
| CBMOAB-85805FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO85805FYA | 100 µg | ||
| MO-AB-22904W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22904W | 100 µg | ||
| MO-AB-15287R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15287R | 100 µg | ||
| MO-AB-27121R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27121R | 100 µg | ||
| MO-AB-04989H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04989C | 100 µg | ||
| MO-AB-26958H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26958C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO23437FYA |
| Specificity | This antibody binds to fruit fly Manf. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Endoplasmic reticulum; Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and results in cell proliferation. Activity of this protein is important in promoting the survival of dopaminergic neurons. The presence of polymorphisms in the N-terminal arginine-rich region, including a specific mutation that changes an ATG start codon to AGG, have been reported in a variety of solid tumors; however, these polymorphisms were later shown to exist in normal tissues and are thus no longer thought to be tumor-related. |
| Product Overview | Mouse Anti-D. melanogaster Manf Antibody is a mouse antibody against Manf. It can be used for Manf detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Mesencephalic astrocyte-derived neurotrophic factor homolog; DmMANF; MANF/CDNF-like protein; Manf; ARP-like |
| UniProt ID | Q9XZ63 |
| Protein Refseq | The length of the protein is 173 amino acids long. The sequence is show below: MKTWYMVVVIGFLATLAQTSLALKEEDCEVCVKTVRRFADSLDDSTKKDYKQIETAFKKFCKAQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAEKICEKLKKKDAQICDLRYEKQIDLNSVDLKKLKVRDLKKILNDWDESCDGCLEKGDFIKRIEELKPKYSRSEL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry