Mouse Anti-MARCH1 Antibody (MO-AB-04285W)


Cat: MO-AB-04285W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04285W Monoclonal Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa) WB, ELISA MO04285W 100 µg
MO-AB-27144R Monoclonal Pig (Sus scrofa) WB, ELISA MO27144R 100 µg
MO-AB-58733W Monoclonal Marmoset WB, ELISA MO58733W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa)
CloneMO04285W
SpecificityThis antibody binds to Rhesus MARCH1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MARCH1 Antibody is a mouse antibody against MARCH1. It can be used for MARCH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesE3 ubiquitin-protein ligase MARCH1 isoform 1; MARCH1
UniProt IDH9F6F2
Protein RefseqThe length of the protein is 283 amino acids long.
The sequence is show below: AIARNPHRIPNNTRTPEISGDLADTSQTSTLNEKSPGRSASRSSNISKASSPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETKLKPLRKWEKLQMTTSERRKIFCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGNDNGVLEWPFWTKLVVVAIGFTGGLVFMYVQCKVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVSQTGTNSLPSAEGGPPEVVSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry