Mouse Anti-Marmoset AADAC Antibody (MO-AB-50155W)


Cat: MO-AB-50155W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO50155W
SpecificityThis antibody binds to Marmoset AADAC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMicrosomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.
Product OverviewMouse Anti-Marmoset AADAC Antibody is a mouse antibody against AADAC. It can be used for AADAC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArylacetamide deacetylase; AADAC
UniProt IDF7BEV5
Protein RefseqThe length of the protein is 399 amino acids long.
The sequence is show below: MGRKSLYLLIVGIFVAYYIYIPLPDNIEEPWRIMWFNTQFTTAEKLAAFVELLGLHHIMDCLKFSLSIYEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWGLGSAALHDYDLLSRWTADRLDAVVISTNYRLAPKYHFPIQFEDVYNSLRWFLRKNVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKFKIQALIYPALQPLDVDSPSYQENSHFPFLHKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGYIYSNPNYGSSELAKKYPGFLDVRAAPLLADDNKLHGLPLTYVVTCQYDVLRDDGLMYVTRLRNAGVQVTHNHIEDGFHGAFSFLELKISHRLINQYIEWLKENL.
See other products for " Aadac "
MO-AB-23929HMouse Anti-Rat Aadac Antibody (MO-AB-23929H)
MO-AB-07034YMouse Anti-Rabbit AADAC Antibody (MO-AB-07034Y)
MO-AB-18241WMouse Anti-Chimpanzee AADAC Antibody (MO-AB-18241W)
MO-AB-06726RMouse Anti-Cattle AADAC Antibody (MO-AB-06726R)
MO-AB-01111HMouse Anti-Frog aadac Antibody (MO-AB-01111H)
CBMOAB-64274FYAMouse Anti-Zebrafish aadac Antibody (CBMOAB-64274FYA)
CBMOAB-34753FYAMouse Anti-Rhesus AADAC Antibody (CBMOAB-34753FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry