Mouse Anti-Marmoset APOO Antibody (MO-AB-51111W)


Cat: MO-AB-51111W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO51111W
SpecificityThis antibody binds to Marmoset APOO.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.
Product OverviewMouse Anti-Marmoset APOO Antibody is a mouse antibody against APOO. It can be used for APOO detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApolipoprotein O; LOC100386288; APOO
UniProt IDF7I3B9
Protein RefseqThe length of the protein is 198 amino acids long.
The sequence is show below: MFKVIQRSVGPASLSLLTFKVYAVPKKDSPPKNSVKVDELSLYSVPKGQSKYVEESRSPLEESISQLRHYCEPYTNWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGCAGLIGLFLARGSKMKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry