Mouse Anti-ATP6V1E1 Antibody (MO-AB-51599W)


Cat: MO-AB-51599W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-51599W Monoclonal Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO51599W 100 µg
MO-AB-24256H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24256C 100 µg
MO-AB-14317Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14317Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO51599W
SpecificityThis antibody binds to Marmoset ATP6V1E1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome.
Product OverviewMouse Anti-Marmoset ATP6V1E1 Antibody is a mouse antibody against ATP6V1E1. It can be used for ATP6V1E1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesV-type proton ATPase subunit E 1 isoform a; ATP6V1E1
UniProt IDU3FJB7
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD.
For Research Use Only | Not For Clinical Use.
Online Inquiry