Mouse Anti-Marmoset CABYR Antibody (MO-AB-52056W)


Cat: MO-AB-52056W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO52056W
SpecificityThis antibody binds to Marmoset CABYR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTo reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene.
Product OverviewMouse Anti-Marmoset CABYR Antibody is a mouse antibody against CABYR. It can be used for CABYR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCalcium-binding tyrosine phosphorylation-regulated protein isoform c; CABYR
UniProt IDU3D8J2
Protein RefseqThe length of the protein is 380 amino acids long.
The sequence is show below: MISSKPRFCIPYGLKTLLEGISIAIIKSNPSNIVQFAAVYFEELTMYREVNTSLDIKDLVKQFHQIKVQKWSEGSIRPKKAECLKEPEKSSVESKVPTHMEKSTDTEEDNVTGTGYSDKTTQFPSTYAELGAEQTEAVHDSSPKAATPKTTTPPFSPPPTAVSPEFAYVPADPAQFAAQMLAMAASEPEQLPPYSNMWTLYCLTDNQQSHSSPPPAPGPFPQATLYISNPKDPQFLQHPPTVTSPIYVMDDTKKISAPPFILVGSKFQKAQEWEPLPGHAVVSQSDVLKRYAAVQVPIAVPADGKFQKHTLSPHNANPPSGQDVPKPKSPVFLSVAFPVEDVAKNNSGSGDKCAPFGSYGIAGEITVATAHKVRKAETEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry