Mouse Anti-Marmoset CASP2 Antibody (MO-AB-52284W)


Cat: MO-AB-52284W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO52284W
SpecificityThis antibody binds to Marmoset CASP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Caspases mediate cellular apoptosis through the proteolytic cleavage of specific protein substrates. The encoded protein may function in stress-induced cell death pathways, cell cycle maintenance, and the suppression of tumorigenesis. Increased expression of this gene may play a role in neurodegenerative disorders including Alzheimer's disease, Huntington's disease and temporal lobe epilepsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product OverviewMouse Anti-Marmoset CASP2 Antibody is a mouse antibody against CASP2. It can be used for CASP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCaspase; CASP2
UniProt IDF7I2T9
Protein RefseqThe length of the protein is 452 amino acids long.
The sequence is show below: MAAPSAESRSTLQHKRLMAADMRRRILGVCGMHPDHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLTCDYDLSLPFPMCESCPPHKKHHLSTDTVEHSLDNKDGPACLQVKSCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKDLEFRSGGDVDHSRLVTLFKLLGYDIHDLHDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFRLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKSHAGSPGCEESDAGKEELLRMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT.
For Research Use Only | Not For Clinical Use.
Online Inquiry