Mouse Anti-Marmoset CASQ2 Antibody (MO-AB-52293W)


Cat: MO-AB-52293W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO52293W
SpecificityThis antibody binds to Marmoset CASQ2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene specifies the cardiac muscle family member of the calsequestrin family. Calsequestrin is localized to the sarcoplasmic reticulum in cardiac and slow skeletal muscle cells. The protein is a calcium binding protein that stores calcium for muscle function. Mutations in this gene cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest.
Product OverviewMouse Anti-Marmoset CASQ2 Antibody is a mouse antibody against CASQ2. It can be used for CASQ2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCalsequestrin; CASQ2
UniProt IDU3FLW7
Protein RefseqThe length of the protein is 407 amino acids long.
The sequence is show below: MKRTHLFIVGVYLLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVAQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDQIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWTTGEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDNEDEGEDDDDDDDDNSDEEDDSDDDNDE.
See other products for " CASQ2 "
MO-AB-43911WMouse Anti-Horse CASQ2 Antibody (MO-AB-43911W)
MO-AB-00174LMouse Anti-Elephant CASQ2 Antibody (MO-AB-00174L)
MO-AB-07445YMouse Anti-Rabbit CASQ2 Antibody (MO-AB-07445Y)
MO-AB-02085HMouse Anti-Frog casq2 Antibody (MO-AB-02085H)
MO-AB-09522RMouse Anti-Cattle CASQ2 Antibody (MO-AB-09522R)
MO-AB-41345WMouse Anti-Guinea pig CASQ2 Antibody (MO-AB-41345W)
CBMOAB-69126FYAMouse Anti-Zebrafish casq2 Antibody (CBMOAB-69126FYA)
MO-AB-19446WMouse Anti-Chimpanzee CASQ2 Antibody (MO-AB-19446W)
MO-AB-14449YMouse Anti-Sheep CASQ2 Antibody (MO-AB-14449Y)
MO-AB-24316RMouse Anti-Pig CASQ2 Antibody (MO-AB-24316R)
For Research Use Only | Not For Clinical Use.
Online Inquiry