Mouse Anti-Marmoset GPT Antibody (MO-AB-56322W)


Cat: MO-AB-56322W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO56322W
SpecificityThis antibody binds to Marmoset GPT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase.
Product OverviewMouse Anti-Marmoset GPT Antibody is a mouse antibody against GPT. It can be used for GPT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlanine aminotransferase 1; GPT
UniProt IDU3B3H2
Protein RefseqThe length of the protein is 496 amino acids long.
The sequence is show below: MASSTVDQSQVARNGLREKVLTLNSMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLNSPNFPDDAKKRAERILQACGGHSLGAYSISSGIQLIREDVAQYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLEEERAWALDVAELHRALCQARDHCCPRALCVINPGNPTGQVQTRECIEDVIRFAFQERLFLLADEVYQDNVYSAGSQFHSFKKVLMEMGPPYAVQQELASFHSTSKGYMGECGFRGGYVEVVNMDPAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFMQFQAERQAVLAELAAKARLTEQVFSEAPGISCNPVQGAMYSFPRIQLPPRAVQLAQELGLAPDMFFCLCLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLTRFHAKFTLEYS.
For Research Use Only | Not For Clinical Use.
Online Inquiry