Mouse Anti-Marmoset GSTZ1 Antibody (MO-AB-56474W)


Cat: MO-AB-56474W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO56474W
SpecificityThis antibody binds to Marmoset GSTZ1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme catalyzes the conversion of maleylacetoacetate to fumarylacetoacatate, which is one of the steps in the phenylalanine/tyrosine degradation pathway. Deficiency of a similar gene in mouse causes oxidative stress. Several transcript variants of this gene encode multiple protein isoforms.
Product OverviewMouse Anti-Marmoset GSTZ1 Antibody is a mouse antibody against GSTZ1. It can be used for GSTZ1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMaleylacetoacetate isomerase isoform 1; GSTZ1
UniProt IDU3AQX4
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: MQAGKPVLYSYFRSSCSWRVRIALALKGIDFEMVPVNLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEETRPTPRLLPQDPKKRASVRMISDLIASGIQPLQNLSILKKVGEVSKDLREETKLTWAQNAITSGFNALEQILQSTAGKYCVGDEVTMADLCLVPQVANAERFKVDFTPYPTISCINKRLLALEAFQLSHPCQQPDTPTELRA.
For Research Use Only | Not For Clinical Use.
Online Inquiry