Mouse Anti-Marmoset IFNAR1 Antibody (MO-AB-57138W)


Cat: MO-AB-57138W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO57138W
SpecificityThis antibody binds to Marmoset IFNAR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.
Product OverviewMouse Anti-Marmoset IFNAR1 Antibody is a mouse antibody against IFNAR1. It can be used for IFNAR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterferon alpha/beta receptor 1; IFNAR1
UniProt IDU3CXP4
Protein RefseqThe length of the protein is 556 amino acids long.
The sequence is show below: MVALLGATTLMLVAVALWVLPAAAGGKHLKSQKVEVDIIDDNFILKWNRIDESLRNATFSFDYQKSGTDNWRKLPGCQNITSTKCNFSSLKLSVYEEIKLRIRAEKENTSSWYEVDPFTPYNKAQIGPPEVHLEAEDKAIMINISPPGTKNSVMWALDGLSFRYSLVIWKNSSSGEEEIKNICSIHKIYKLSPETTYCLKVKAALPKASKVGLYGPVYCIKTTVENKLPPPKNIEVSVLNQSYVLKWDYAYANMTFQVQWLQAFLKRNPVNHSNKWKQMPDCENVKTTQCVFPQNVLPNGIYLLRLQASDGNNTSFWSEEIKLDTEIQAFLLPPVLNVRSASDSLHIYIGAPKESGSKPVSQDYPLTYEIIFWENTSNAERKIFKNKTDFIVPNLKPLTVYCVKARAHAMDEKWNKSSAFSDVVFVKTKPGNASKIWFIVGICTALFAIPALIYGVKVLLRCINYVFFPSLKPSSNIDEYFSEQSLKNLLLSTSEEKIEKCFIIENICTIATVEETNQTDEDHKQYSSQNCQDSGNYSNEDESESKTSEELQQDFV.
See other products for " IFNAR1 "
MO-AB-13978RMouse Anti-Cattle IFNAR1 Antibody (MO-AB-13978R)
MOXC-039WMouse Anti-Chicken IFNAR1 (VPLEDKEGLF) Antibody
MO-AB-11729YMouse Anti-O. mykiss Ifnar1 Antibody (MO-AB-11729Y)
MO-AB-20689WMouse Anti-Chimpanzee IFNAR1 Antibody (MO-AB-20689W)
MOXC-041WMouse Anti-Chicken IFNAR1 (DDNTSQSKGSEETL) Antibody
MOXC-040WMouse Anti-Chicken IFNAR1 (EANQVRKMWL) Antibody
MO-AB-02397YMouse Anti-Chicken IFNAR1 Antibody (MO-AB-02397Y)
CBMOAB-45076FYAMouse Anti-Rhesus IFNAR1 Antibody (CBMOAB-45076FYA)
MO-AB-26507RMouse Anti-Pig IFNAR1 Antibody (MO-AB-26507R)
MO-AB-02400YMouse Anti-Chicken IFNAR1 Antibody (MO-AB-02400Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry