Mouse Anti-Marmoset IL11RA Antibody (MO-AB-57190W)


Cat: MO-AB-57190W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO57190W
SpecificityThis antibody binds to Marmoset IL11RA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInterleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. This gene encodes the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain. Multiple alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Marmoset IL11RA Antibody is a mouse antibody against IL11RA. It can be used for IL11RA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin-11 receptor subunit alpha; IL11RA
UniProt IDU3F297
Protein RefseqThe length of the protein is 422 amino acids long.
The sequence is show below: MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQLGRSVKLCCPGVIAGDPVSWFRDGEPGLLQGPDSGLGHELVLAQADSTDEGTYICRTLDGTLGGTVILQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRKSPSPEPWPCPQDPLGAARCVVHGAEFWSQYRINVTEMNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPRQPHFLLKFRLQYRPAQHLVWSMLEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEVPAGDQLHIQPEAEPQEDSPAPPRPSLQPHPQLLDHRDSMEQVAVLASLGVLSFLGLVAGALALGLWLRLRQSGKDGSLKPGFLSPMIPVDRRPGVPNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry