Mouse Anti-Marmoset MYD88 Antibody (MO-AB-59597W)


Cat: MO-AB-59597W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO59597W
SpecificityThis antibody binds to Marmoset MYD88.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.
Product OverviewMouse Anti-Marmoset MYD88 Antibody is a mouse antibody against MYD88. It can be used for MYD88 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyeloid differentiation primary response protein MyD88; MYD88
UniProt IDF7EB56
Protein RefseqThe length of the protein is 285 amino acids long.
The sequence is show below: MAAEGPGAGSVTPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTVLAEEMDFEYLEIRQLESHADPTGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVASVDSSVPRTTELAGITTLDDPLGQMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMNKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry