Mouse Anti-Marmoset NAT1 Antibody (MO-AB-59737W)


Cat: MO-AB-59737W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO59737W
SpecificityThis antibody binds to Marmoset NAT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Marmoset NAT1 Antibody is a mouse antibody against NAT1. It can be used for NAT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArylamine N-acetyltransferase 1 isoform a; NAT1
UniProt IDU3FNG6
Protein RefseqThe length of the protein is 290 amino acids long.
The sequence is show below: MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGEAMDLDLGAIFDQIVRRNRGGWCLQVNHLLYWALTTIGFETKILGGYVYSTPAKKYSTGMIHLLLQVTIDGKNYIVDAGFGRSYQIWQPLELISGKDQPQVPCIFRLTEENGFWYLDQIRRDQYIPNEEFLNSDLIESSKYRKIYSFTLEPRTIEDFESMNTYLQTSPASVFTSKSFCSLQTPEGVHCLVGFTLTYRRFNYKDNTDLIEFKTLNEEEIEKALKNIFNISLERKLVPKHGDRFFTI.
For Research Use Only | Not For Clinical Use.
Online Inquiry