Mouse Anti-Marmoset NIP7 Antibody (MO-AB-60077W)


Cat: MO-AB-60077W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO60077W
SpecificityThis antibody binds to Marmoset NIP7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for proper 27S pre-rRNA processing and 60S ribosome subunit assembly.
Product OverviewMouse Anti-Marmoset NIP7 Antibody is a mouse antibody against NIP7. It can be used for NIP7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names60S ribosome subunit biogenesis protein NIP7 homolog; NIP7
UniProt IDU3EQB5
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADVPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT.
See other products for " NIP7 "
MO-AB-42140WMouse Anti-Guinea pig NIP7 Antibody (MO-AB-42140W)
MO-AB-16745RMouse Anti-Cattle NIP7 Antibody (MO-AB-16745R)
MO-AB-22813WMouse Anti-Chimpanzee NIP7 Antibody (MO-AB-22813W)
MO-AB-45785WMouse Anti-Horse NIP7 Antibody (MO-AB-45785W)
MO-AB-01033RMouse Anti-Medaka nip7 Antibody (MO-AB-01033R)
MO-AB-33488HMouse Anti-Nile tilapia nip7 Antibody (MO-AB-33488H)
CBMOAB-02597CRMouse Anti-Yeast NIP7 Antibody (CBMOAB-02597CR)
MO-AB-00894LMouse Anti-Elephant NIP7 Antibody (MO-AB-00894L)
MO-AB-27486HMouse Anti-Rat Nip7 Antibody (MO-AB-27486H)
MO-AB-08954YMouse Anti-Rabbit NIP7 Antibody (MO-AB-08954Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry