Mouse Anti-Marmoset PEX12 Antibody (MO-AB-61315W)


Cat: MO-AB-61315W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO61315W
SpecificityThis antibody binds to Marmoset PEX12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the peroxin-12 family. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS).
Product OverviewMouse Anti-Marmoset PEX12 Antibody is a mouse antibody against PEX12. It can be used for PEX12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPeroxisome assembly protein 12; PEX12
UniProt IDF7DDX6
Protein RefseqThe length of the protein is 359 amino acids long.
The sequence is show below: MAEHGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKKHLWKSIMFLVLLPYMKVKLEKLVASLREEDEYSIHPPSSRRKRFYRAFLAAYPFVNMAWEGWFLVQQLQYILGKAQHHSPLLRLAGVRLGRLTVQDIQALEHKPAEASVMQEPVRSVSEKIKSALKKAVGGVALSLSTGLSLGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry