Mouse Anti-Marmoset RBFA Antibody (MO-AB-63028W)
Cat: MO-AB-63028W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Marmoset |
Clone | MO63028W |
Specificity | This antibody binds to Marmoset RBFA. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | One of at least 4 proteins (Era, RbfA, RimM and RsgA/YjeQ) that assist in the late maturation steps of the functional core of the 30S subunit. Essential for efficient processing of pre-16S rRNA (PubMed:9422595, PubMed:12963368, PubMed:12628255). Probably part of the 30S subunit prior to or during the final step in the processing of 16S free 30S ribosomal subunits. Probably interacts with the 5''-terminal helix region of 16S rRNA (PubMed:7535280). Has affinity for free ribosomal 30S subunits but not for 70S ribosomes (PubMed:7535280, PubMed:12963368). Overexpression suppresses a cold-sensitive C23U 16S rRNA mutation (PubMed:7535280). Overexpression decreases the lag time following cold-shock by about half, leading to faster adaptation and increased protein synthesis (PubMed:8898389). Overexpression also partially suppresses a rimM deletion mutant and partially rescues its 16S rRNA processing deficiency (PubMed:9422595). Its function overlaps that of Era in ribosome biogenesis (PubMed:16825789). A number of RbfA mutants suppress RsgA/YjeQ deletions, in all cases less RbfA is bound to the 30S ribosome (PubMed:21102555). Released from 30S ribosomes by RsgA; stimulates the ribosome-associated GTPase activity of RsgA (PubMed:21102555). |
Product Overview | Mouse Anti-Marmoset RBFA Antibody is a mouse antibody against RBFA. It can be used for RBFA detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Putative ribosome-binding factor A, mitochondrial isoform 1; RBFA |
UniProt ID | U3EMF0 |
Protein Refseq | The length of the protein is 343 amino acids long. The sequence is show below: MWAVAGGLWGSRAGLRVLLRSRDAALVPDFARGLHGSTVSCKNWLKKFASKTKKKFWYEGPSLGSHLTYKPSKLEFLMRSTSQKTRKEDHVRLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRVYWKTTLSAEQNVRTETVLQKSAAHMRHLLMSQQTLRNVPPIVFVKDKQSAALAEIDQLLAVADFGPPDQRDDFVRNDFRNLDAPRPCGTTEPATSSSLCGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTAQMKKGRKKAKRVLEQDSSLKSYLSGEEGEDDLDLDGTLEYECSAPDTEELEAERRGSITEDDRSCRARGE. |
See other products for " rbfA "
CBMOAB-2245YC | Mouse Anti-E. coli rbfA Antibody (CBMOAB-2245YC) |
MO-AB-26555W | Mouse Anti-Chimpanzee RBFA Antibody (MO-AB-26555W) |
CBMOAB-64044FYA | Mouse Anti-Zebrafish rbfa Antibody (CBMOAB-64044FYA) |
MO-AB-28367H | Mouse Anti-Rat Rbfa Antibody (MO-AB-28367H) |
CBMOAB-56144FYA | Mouse Anti-Rhesus RBFA Antibody (CBMOAB-56144FYA) |
MO-AB-05561W | Mouse Anti-Rhesus RBFA Antibody (MO-AB-05561W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry