Mouse Anti-Marmoset RBFA Antibody (MO-AB-63028W)


Cat: MO-AB-63028W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO63028W
SpecificityThis antibody binds to Marmoset RBFA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOne of at least 4 proteins (Era, RbfA, RimM and RsgA/YjeQ) that assist in the late maturation steps of the functional core of the 30S subunit. Essential for efficient processing of pre-16S rRNA (PubMed:9422595, PubMed:12963368, PubMed:12628255). Probably part of the 30S subunit prior to or during the final step in the processing of 16S free 30S ribosomal subunits. Probably interacts with the 5''-terminal helix region of 16S rRNA (PubMed:7535280). Has affinity for free ribosomal 30S subunits but not for 70S ribosomes (PubMed:7535280, PubMed:12963368). Overexpression suppresses a cold-sensitive C23U 16S rRNA mutation (PubMed:7535280). Overexpression decreases the lag time following cold-shock by about half, leading to faster adaptation and increased protein synthesis (PubMed:8898389). Overexpression also partially suppresses a rimM deletion mutant and partially rescues its 16S rRNA processing deficiency (PubMed:9422595). Its function overlaps that of Era in ribosome biogenesis (PubMed:16825789). A number of RbfA mutants suppress RsgA/YjeQ deletions, in all cases less RbfA is bound to the 30S ribosome (PubMed:21102555). Released from 30S ribosomes by RsgA; stimulates the ribosome-associated GTPase activity of RsgA (PubMed:21102555).
Product OverviewMouse Anti-Marmoset RBFA Antibody is a mouse antibody against RBFA. It can be used for RBFA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative ribosome-binding factor A, mitochondrial isoform 1; RBFA
UniProt IDU3EMF0
Protein RefseqThe length of the protein is 343 amino acids long.
The sequence is show below: MWAVAGGLWGSRAGLRVLLRSRDAALVPDFARGLHGSTVSCKNWLKKFASKTKKKFWYEGPSLGSHLTYKPSKLEFLMRSTSQKTRKEDHVRLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRVYWKTTLSAEQNVRTETVLQKSAAHMRHLLMSQQTLRNVPPIVFVKDKQSAALAEIDQLLAVADFGPPDQRDDFVRNDFRNLDAPRPCGTTEPATSSSLCGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTAQMKKGRKKAKRVLEQDSSLKSYLSGEEGEDDLDLDGTLEYECSAPDTEELEAERRGSITEDDRSCRARGE.
For Research Use Only | Not For Clinical Use.
Online Inquiry