Mouse Anti-Marmoset WNT10B Antibody (MO-AB-67908W)


Cat: MO-AB-67908W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO67908W
SpecificityThis antibody binds to Marmoset WNT10B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It may be involved in breast cancer, and its protein signaling is likely a molecular switch that governs adipogenesis. This protein is 96% identical to the mouse Wnt10b protein at the amino acid level. This gene is clustered with another family member, WNT1, in the chromosome 12q13 region.
Product OverviewMouse Anti-Marmoset WNT10B Antibody is a mouse antibody against WNT10B. It can be used for WNT10B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Wnt; WNT10B
UniProt IDU3C710
Protein RefseqThe length of the protein is 389 amino acids long.
The sequence is show below: MLEEPRPRPPPSGFAGLLFLALCSRALSNEILGLKLPGEPPLTPNTVCLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFSFSMLAAGIMHAVATACSLGKLVSCGCGLKGSGEQDRLRAKLLQLQTLSRGKSFPHSLPSPGPGSGPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVEHCHCRFHWCCYVLCDECKVTEWVNVCK.
For Research Use Only | Not For Clinical Use.
Online Inquiry