Mouse Anti-MBD3 Antibody (MO-AB-15402R)


Cat: MO-AB-15402R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15402R Monoclonal Cattle (Bos taurus), Frog (Xenopus laevis) WB, ELISA MO15402R 100 µg
MO-AB-05063H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05063C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Frog (Xenopus laevis)
CloneMO15402R
SpecificityThis antibody binds to Cattle MBD3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. This gene belongs to a family of nuclear proteins which are characterized by the presence of a methyl-CpG binding domain (MBD). The encoded protein is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. Unlike the other family members, the encoded protein is not capable of binding to methylated DNA. The protein mediates the association of metastasis-associated protein 2 with the core histone deacetylase complex. Alternative splicing results in multiple transcript variants of this gene.
Product OverviewMouse Anti-Cattle MBD3 Antibody is a mouse antibody against MBD3. It can be used for MBD3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMBD3 protein; MBD3
UniProt IDA2VDN2
Protein RefseqThe length of the protein is 257 amino acids long.
The sequence is show below: MERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKVNKGRQRVRYDSPSQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVEQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTTPITGQLSAAVEKNPGVWLNTAQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDRVGADDEEDEDEEEEEPDQDPEMELP.
For Research Use Only | Not For Clinical Use.
Online Inquiry