Mouse Anti-MCHR1 Antibody (CBMOAB-50987FYA)


Cat: CBMOAB-50987FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-50987FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Pig (Sus scrofa) WB, ELISA MO50987FYA 100 µg
MO-AB-04343W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04343W 100 µg
MO-AB-15452R Monoclonal Cattle (Bos taurus) WB, ELISA MO15452R 100 µg
MO-AB-24948W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24948W 100 µg
MO-AB-27218R Monoclonal Pig (Sus scrofa) WB, ELISA MO27218R 100 µg
MO-AB-31728W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31728W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Pig (Sus scrofa)
CloneMO50987FYA
SpecificityThis antibody binds to Rhesus MCHR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin.
Product OverviewMouse Anti-Rhesus MCHR1 Antibody is a mouse antibody against MCHR1. It can be used for MCHR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMelanin-concentrating hormone receptor 1; MCHR1
UniProt IDG1K379
Protein RefseqThe length of the protein is 422 amino acids long.
The sequence is show below: MSVRAAKEGVGRAVGLGGGSGCQAAKEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSAWLWEPATSTGWMDLEASLLPTGPNTSNTSDGPDNLTSAGSPPRSGSVSYINIIMPSVFGTICLLGIIGNSMVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT.
For Research Use Only | Not For Clinical Use.
Online Inquiry