AibGenesis™ Mouse Anti-MEAF6 Antibody (CBMOAB-51078FYA)


Cat: CBMOAB-51078FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51078FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO51078FYA 100 µg
CBMOAB-86393FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86393FYA 100 µg
MO-AB-15505R Monoclonal Cattle (Bos taurus) WB, ELISA MO15505R 100 µg
MO-AB-27027H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27027C 100 µg
MO-AB-58904W Monoclonal Marmoset WB, ELISA MO58904W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO51078FYA
SpecificityThis antibody binds to Rhesus MEAF6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nuclear protein involved in transcriptional activation. The encoded protein may form a component of several different histone acetyltransferase complexes. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus MEAF6 Antibody is a mouse antibody against MEAF6. It can be used for MEAF6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChromatin modification-related protein MEAF6; MEAF6
UniProt IDH9FYJ2
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHSPSGMFDYDFEIDLKLNKKPRADY.
For Research Use Only | Not For Clinical Use.
Online Inquiry