Mouse Anti-MED10 Antibody (MO-AB-00317W)
Cat: MO-AB-00317W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-00317W | Monoclonal | Barrel medic (Medicago truncatula), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Ferret (Mustela Putorius Furo), French-bean, Fruit fly (Drosophila melanogaster), Mallard (Anas platyrhynchos), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Sea-anemone, Zebrafish (Danio rerio) | WB, ELISA | MO00317W | 100 µg | ||
CBMOAB-23563FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO23563FYA | 100 µg | ||
CBMOAB-86408FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO86408FYA | 100 µg | ||
MO-AB-11695W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11695W | 100 µg | ||
MO-AB-27800W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27800W | 100 µg | ||
MO-AB-35104W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35104W | 100 µg | ||
MO-AB-36283W | Monoclonal | French-bean | WB, ELISA | MO36283W | 100 µg | ||
MO-AB-58912W | Monoclonal | Marmoset | WB, ELISA | MO58912W | 100 µg | ||
MO-AB-15510R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15510R | 100 µg | ||
MO-AB-23424H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23424C | 100 µg | ||
MO-AB-27029H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27029C | 100 µg | ||
MO-AB-12037Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO12037Y | 100 µg | ||
MO-AB-13907Y | Monoclonal | Sea-anemone | WB, ELISA | MO13907Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Barrel medic (Medicago truncatula), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Ferret (Mustela Putorius Furo), French-bean, Fruit fly (Drosophila melanogaster), Mallard (Anas platyrhynchos), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Sea-anemone, Zebrafish (Danio rerio) |
Clone | MO00317W |
Specificity | This antibody binds to Barrel medic MED10. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | MED10 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]). |
Product Overview | Mouse Anti-Barrel medic MED10 Antibody is a mouse antibody against MED10. It can be used for MED10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Mediator Complex Subunit 10; Transformation-Related Gene 17 Protein; Transformation-Related Gene 20 Protein; TRG-17; TRG-20; Mediator Of RNA Polymerase II Transcription, Subunit 10 Homolog (NUT2, S. Cerevisiae); Mediator Of RNA Polymerase II Transcription, Subunit 10 |
UniProt ID | I3S068 |
Protein Refseq | The length of the protein is 186 amino acids long. The sequence is show below: MDSSQSPAAGGNGTLISHGNDAAASASGADDSIQNLSQISNSIEKTLGLIHQLSLTVSTFNSALQMPLLQRINGLVVELDNMVKLAEKCNIQVPMEVVNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDALKDLRKHLLEELEQNFPDEVETFRENRAAAAAELKRLAQAPSVLPNGGARAKVEH. |
For Research Use Only | Not For Clinical Use.
Online Inquiry