Mouse Anti-MED10 Antibody (MO-AB-00317W)


Cat: MO-AB-00317W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00317W Monoclonal Barrel medic (Medicago truncatula), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Ferret (Mustela Putorius Furo), French-bean, Fruit fly (Drosophila melanogaster), Mallard (Anas platyrhynchos), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Sea-anemone, Zebrafish (Danio rerio) WB, ELISA MO00317W 100 µg
CBMOAB-23563FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO23563FYA 100 µg
CBMOAB-86408FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86408FYA 100 µg
MO-AB-11695W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11695W 100 µg
MO-AB-27800W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO27800W 100 µg
MO-AB-35104W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35104W 100 µg
MO-AB-36283W Monoclonal French-bean WB, ELISA MO36283W 100 µg
MO-AB-58912W Monoclonal Marmoset WB, ELISA MO58912W 100 µg
MO-AB-15510R Monoclonal Cattle (Bos taurus) WB, ELISA MO15510R 100 µg
MO-AB-23424H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23424C 100 µg
MO-AB-27029H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27029C 100 µg
MO-AB-12037Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12037Y 100 µg
MO-AB-13907Y Monoclonal Sea-anemone WB, ELISA MO13907Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Ferret (Mustela Putorius Furo), French-bean, Fruit fly (Drosophila melanogaster), Mallard (Anas platyrhynchos), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Sea-anemone, Zebrafish (Danio rerio)
CloneMO00317W
SpecificityThis antibody binds to Barrel medic MED10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMED10 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]).
Product OverviewMouse Anti-Barrel medic MED10 Antibody is a mouse antibody against MED10. It can be used for MED10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator Complex Subunit 10; Transformation-Related Gene 17 Protein; Transformation-Related Gene 20 Protein; TRG-17; TRG-20; Mediator Of RNA Polymerase II Transcription, Subunit 10 Homolog (NUT2, S. Cerevisiae); Mediator Of RNA Polymerase II Transcription, Subunit 10
UniProt IDI3S068
Protein RefseqThe length of the protein is 186 amino acids long.
The sequence is show below: MDSSQSPAAGGNGTLISHGNDAAASASGADDSIQNLSQISNSIEKTLGLIHQLSLTVSTFNSALQMPLLQRINGLVVELDNMVKLAEKCNIQVPMEVVNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDALKDLRKHLLEELEQNFPDEVETFRENRAAAAAELKRLAQAPSVLPNGGARAKVEH.
For Research Use Only | Not For Clinical Use.
Online Inquiry