AibGenesis™ Mouse Anti-Med22 Antibody (CBMOAB-23580FYA)


Cat: CBMOAB-23580FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23580FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO23580FYA 100 µg
CBMOAB-86439FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86439FYA 100 µg
MO-AB-15519R Monoclonal Cattle (Bos taurus) WB, ELISA MO15519R 100 µg
MO-AB-22324W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22324W 100 µg
MO-AB-27037H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27037C 100 µg
MO-AB-58926W Monoclonal Marmoset WB, ELISA MO58926W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO23580FYA
SpecificityThis antibody binds to fruit fly Med22.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein component of the mediator complex, which functions in the regulation of transcription by bridging interactions between gene-specific regulatory factors, RNA polymerase II, and general transcription factors. Alternatively spliced transcript variants encoding different isoforms have been observed. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Med22 Antibody is a mouse antibody against Med22. It can be used for Med22 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator of RNA polymerase II transcription subunit 22; Mediator complex subunit 22; dMED24; MED22; Med24
UniProt IDQ9V439
Protein RefseqThe length of the protein is 143 amino acids long.
The sequence is show below: MASGSRTTILPQSKEALLKSYNARLKDDVRSMLENFEEILKLARRESHSQISKTTQCEQDALEMQVRAANMVRAGESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYYTSIFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry