Mouse Anti-Med31 Antibody (CBMOAB-23589FYA)


Cat: CBMOAB-23589FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23589FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO23589FYA 100 µg
CBMOAB-36360FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO36360FC 100 µg
CBMOAB-86461FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86461FYA 100 µg
MO-AB-12054Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12054Y 100 µg
MO-AB-15530R Monoclonal Cattle (Bos taurus) WB, ELISA MO15530R 100 µg
MO-AB-27041H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27041C 100 µg
MO-AB-58944W Monoclonal Marmoset WB, ELISA MO58944W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO23589FYA
SpecificityThis antibody binds to fruit fly Med31.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMED31 (Mediator Complex Subunit 31) is a Protein Coding gene. Among its related pathways are Gene Expression and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). Gene Ontology (GO) annotations related to this gene include protein complex binding and RNA polymerase II transcription cofactor activity.
Product OverviewMouse Anti-D. melanogaster Med31 Antibody is a mouse antibody against Med31. It can be used for Med31 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator of RNA polymerase II transcription subunit 31; Mediator complex subunit 31; Protein SOH1; dSOH1; MED31; Trap18
UniProt IDQ8IH24
Protein RefseqThe length of the protein is 204 amino acids long.
The sequence is show below: MAKMYGKGKTAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQANGMEAATGGESAAPTPNVNGSASTADSQQTSSALQPVQAQPGNPQQQQQINGVASGANIKLELN.
For Research Use Only | Not For Clinical Use.
Online Inquiry