Mouse Anti-Medaka CYP21A2 Antibody (MO-AB-00297R)


Cat: MO-AB-00297R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO00297R
SpecificityThis antibody binds to Medaka CYP21A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP21A2 (Cytochrome P450 Family 21 Subfamily A Member 2) is a Protein Coding gene. Diseases associated with CYP21A2 include Adrenal Hyperplasia, Congenital, Due To 21-Hydroxylase Deficiency and Classic Congenital Adrenal Hyperplasia Due To 21-Hydroxylase Deficiency, Simple Virilizing Form. Among its related pathways are superpathway of steroid hormone biosynthesis and Aldosterone synthesis and secretion. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP17A1.
Product OverviewThis product is a mouse antibody against CYP21A2. It can be used for CYP21A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome P450 21-hydroxylase type A2, Fragment; CYP21A2
UniProt IDA5HL67
Protein RefseqThe length of the protein is 87 amino acids long.
The sequence is show below: PHRAIRNSSIAGFFIPKNSVIIPNLFGAHHDPAVWSEPYSFKPERFLEGGGGSTRALVPFGGGARLCLGESVAKMELFLFTAYLLRD.
For Research Use Only | Not For Clinical Use.
Online Inquiry