Mouse Anti-Medaka CYP21A2 Antibody (MO-AB-00297R)
Cat: MO-AB-00297R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Medaka (Oryzias latipes) |
Clone | MO00297R |
Specificity | This antibody binds to Medaka CYP21A2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CYP21A2 (Cytochrome P450 Family 21 Subfamily A Member 2) is a Protein Coding gene. Diseases associated with CYP21A2 include Adrenal Hyperplasia, Congenital, Due To 21-Hydroxylase Deficiency and Classic Congenital Adrenal Hyperplasia Due To 21-Hydroxylase Deficiency, Simple Virilizing Form. Among its related pathways are superpathway of steroid hormone biosynthesis and Aldosterone synthesis and secretion. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP17A1. |
Product Overview | This product is a mouse antibody against CYP21A2. It can be used for CYP21A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cytochrome P450 21-hydroxylase type A2, Fragment; CYP21A2 |
UniProt ID | A5HL67 |
Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: PHRAIRNSSIAGFFIPKNSVIIPNLFGAHHDPAVWSEPYSFKPERFLEGGGGSTRALVPFGGGARLCLGESVAKMELFLFTAYLLRD. |
See other products for " CYP21A2 "
CBMOAB-40228FYA | Mouse Anti-Rhesus CYP21A2 Antibody (CBMOAB-40228FYA) |
CBMOAB-72620FYA | Mouse Anti-Zebrafish cyp21a2 Antibody (CBMOAB-72620FYA) |
MO-AB-25027R | Mouse Anti-Pig CYP21A2 Antibody (MO-AB-25027R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry