Mouse Anti-Medaka kat5 Antibody (MO-AB-00789R)


Cat: MO-AB-00789R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO00789R
SpecificityThis antibody binds to Medaka kat5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against kat5. It can be used for kat5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone acetyltransferase; EC 2.3.1.48; LOC101161500
UniProt IDH2LTD2
Protein RefseqThe length of the protein is 542 amino acids long.
The sequence is show below: MADNCSSVEIVEGCRLPVLRKNQEHEDEWPLAEILSLKEVSGRKLFYVHYIDFNKRLDEWVTADRLDMKKLQFPKKEAKTPTKNGLSGSRPSSPERAESRKTLDLNLQSATAPSRGKTLPTPVQKRKEVVPLVTPVPPATPVPALPSSTETSQAAVFPVVREPPPFKAREDLEPIPTVTTNGTARRLIPPQPGRKRKANCGGPDEMIKVLQYNKPQSAAVFLPPPEDSQDSSDGIPTAPRMTGSLVSDRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKNYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDSKGFHIVGYFSKEVKNXEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKPDNGERPQITINEISEITSVKKEDVISTLQYLNLINYYKGQYILTLSEEIVDGHEKAMQKRHLRIDPKCLHFTPKDWSKRGKW.
For Research Use Only | Not For Clinical Use.
Online Inquiry