Mouse Anti-Medaka wnt5a Antibody (MO-AB-01915R)


Cat: MO-AB-01915R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO01915R
SpecificityThis antibody binds to Medaka wnt5a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against wnt5a. It can be used for wnt5a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Wnt, Fragment; wnt5a
UniProt IDO42117
Protein RefseqThe length of the protein is 114 amino acids long.
The sequence is show below: GSCSLKTCWLQLADFRKVGDLLKEKYDSAAAMKLNSRGRMVQMHSKFNAPTGDDLVYIDPSPDYCLKNQSTGSLGTVGRLCNKTSEGMDGCELMCCGRGYDQFKAEIVERCHCK.
For Research Use Only | Not For Clinical Use.
Online Inquiry