AibGenesis™ Mouse Anti-METTL15 Antibody (CBMOAB-51182FYA)


Cat: CBMOAB-51182FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51182FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO51182FYA 100 µg
MO-AB-04388W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04388W 100 µg
MO-AB-05127H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05127C 100 µg
MO-AB-15579R Monoclonal Cattle (Bos taurus) WB, ELISA MO15579R 100 µg
MO-AB-20248W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20248W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO51182FYA
SpecificityThis antibody binds to Rhesus METTL15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus METTL15 Antibody is a mouse antibody against METTL15. It can be used for METTL15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMETTL15
UniProt IDF7GN12
Protein RefseqThe length of the protein is 259 amino acids long.
The sequence is show below: MLRYPYFCRMYKECLSCWLASGIPNLGVWPKRIHTTAEKYGEYEAQEQTDQTQAQELHRSQDRDFETMAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAVLGQFSQAEALLTKAGVQPGTFDGVLMDLGCSSMQLDTPERGFSLRKDGPLDMRMDGGRYPDMPTAADVVNALDQPALASILRTYGEEKHARKIASAIVQARSIYPITRTQQLASIVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry