AibGenesis™ Mouse Anti-METTL18 Antibody (CBMOAB-51189FYA)


Cat: CBMOAB-51189FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51189FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO51189FYA 100 µg
MO-AB-05129H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05129C 100 µg
MO-AB-15583R Monoclonal Cattle (Bos taurus) WB, ELISA MO15583R 100 µg
MO-AB-25338W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25338W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO51189FYA
SpecificityThis antibody binds to Rhesus METTL18.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus METTL18 Antibody is a mouse antibody against METTL18. It can be used for METTL18 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistidine protein methyltransferase 1 homolog; METTL18
UniProt IDI0FWD9
Protein RefseqThe length of the protein is 91 amino acids long.
The sequence is show below: MTFQFNFTIEDHLENELTPTGDGALTLDSSKELSVSESQKGEDMDRKCSAEQFDLPQGHLWEHKSMENAAPSQDTDSPLSAANNSSNLEPY.
For Research Use Only | Not For Clinical Use.
Online Inquiry