Mouse Anti-METTL21C Antibody (CBMOAB-51192FYA)


Cat: CBMOAB-51192FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51192FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO51192FYA 100 µg
MO-AB-15586R Monoclonal Cattle (Bos taurus) WB, ELISA MO15586R 100 µg
MO-AB-27054H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27054C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO51192FYA
SpecificityThis antibody binds to Rhesus METTL21C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus METTL21C Antibody is a mouse antibody against METTL21C. It can be used for METTL21C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMETTL21C
UniProt IDF7HFB3
Protein RefseqThe length of the protein is 264 amino acids long.
The sequence is show below: MDVCLSSAQQPGRREEGLSSPGGWLEAEKKGASQKDSTGAALEESNRIEASLHSLQKFVPTDYASYTQEHYRFAGKEIVIQESIESYGAVVWPGATALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQYNLLRNTLRCTAHLPEVKELVWGEDLHKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPGSSVKLFKGILKWD.
For Research Use Only | Not For Clinical Use.
Online Inquiry