Mouse Anti-mettl26 Antibody (CBMOAB-61222FYC)


Cat: CBMOAB-61222FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61222FYC Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus) WB, ELISA MO61222FYC 100 µg
MO-AB-27057H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27057C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus)
CloneMO61222FYC
SpecificityThis antibody binds to Zebrafish mettl26.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish mettl26 Antibody is a mouse antibody against mettl26. It can be used for mettl26 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUPF0585 protein C16orf13 homolog A; mettl26
UniProt IDQ7ZVJ8
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: MLNAAAADRNKDPILSVLKSRVASNRRLFALEISSGTGQHVVHFAKAFPNITWQPSEVETQSLSSIEAYRQYHRLQNVQPPIYLDVSQSWQTWGGFPAESCDLIININMMHISPLACTTGLFHGVGQILKPQGLLLTYGPYAFNGSIVPQSNFDFDQSLRYRNPEWGLRDASFLTTLGQENGLRLEEIVDMPANNKCLLFRKDSVV.
For Research Use Only | Not For Clinical Use.
Online Inquiry