AibGenesis™ Mouse Anti-METTL9 Antibody (CBMOAB-51205FYA)


Cat: CBMOAB-51205FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51205FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO51205FYA 100 µg
CBMOAB-86637FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86637FYA 100 µg
MO-AB-02895Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02895Y 100 µg
MO-AB-04391W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04391W 100 µg
MO-AB-05135H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05135C 100 µg
MO-AB-15593R Monoclonal Cattle (Bos taurus) WB, ELISA MO15593R 100 µg
MO-AB-22704W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22704W 100 µg
MO-AB-27063H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27063C 100 µg
MO-AB-37667W Monoclonal Goat (Capra hircus) WB, ELISA MO37667W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO51205FYA
SpecificityThis antibody binds to Rhesus METTL9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus METTL9 Antibody is a mouse antibody against METTL9. It can be used for METTL9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMETTL9
UniProt IDF6RDD8
Protein RefseqThe length of the protein is 306 amino acids long.
The sequence is show below: MRLLVGWLCLSLASVWLAQRMWTLRSPLTRSLYVNMTSGPGGPATAAGGRKENDQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYY.
For Research Use Only | Not For Clinical Use.
Online Inquiry